Stock: In Stock
C133H227N43O33ACE-031 1mg (95% Untagged Premium)
ACE-031 1mg — a research-grade myostatin pathway inhibitor at 95% purity.
from
$79.00
Research Handling Note:
For best results, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Reconstitution solutions are supplied separately.
Selling fast
Purity: ≥98%
Thymosin Beta 4 2mg (TB500)
from
$16.95
5 or more$16.50
10 or more$15.50
25 or more$14.00
50 or more$13.00
Stock:In Stock
Model:TB2-022
Molecular Formula:C212H350N56O78S
Purity:≥98%
Molecular Weight:4,963.4 g/mol
Research Only:Yes
1
≥99% Purity HPLC Verified Same-Day Dispatch UK Based
Description
Technical Data
Thymosin Beta 4 2mg (TB500) — Research Peptide
TB-500, offered at 2mg, is a high-quality specialised research peptide developed for advanced scientific exploration in cellular biology and actin-related signalling pathways. This product is ideal for laboratory settings where precision and reliability are paramount.
TB-500 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.
Peptide Sequence
SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Usage and Storage
Thymosin Beta 4 2mg (TB500)is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.
Legal and Safety Information
US-Peptides proudly provides Thymosin Beta 4 2mg (TB500) strictly for scientific and research use. We are dedicated to supporting the research community and ensuring our products meet stringent quality standards and legal requirements. Our peptides are not designed for human consumption or clinical application.
Tags:TB500Thymosin Beta-4
Related Products
Stock: In Stock
C207H308N56O58S1ACTH 1-39 5mg
ACTH 1-39 5mg — full-length adrenocorticotropic hormone for research.
from
$85.00
Stock: In Stock
C22H52N16O6ADAMAX 5mg
ADAMAX 5mg — research-grade peptide for cognitive function studies.
from
$49.00
Stock: In Stock
C78H123N23O23S2AOD 9604 2MG
AOD 9604 2mg — a modified fragment of human growth hormone for research.
from
$27.95