Stock: In Stock
C133H227N43O33ACE-031 1mg (95% Untagged Premium)
ACE-031 1mg — a research-grade myostatin pathway inhibitor at 95% purity.
from
$79.00
FREE US DELIVERY on orders over $50 • Same Day Dispatch Before 4PM (Mon–Fri) • ≥99% Purity Guaranteed
Research Handling Note:
For best results, allow both the peptide and chosen solvent to reach ambient laboratory temperature before reconstitution. This helps maintain structural integrity during dissolution. *Reconstitution solutions are supplied separately.

from
$12.95
Sermorelin Acetate 2mg — a 29 amino acid synthetic GHRH analogue for endocrinology research.
Sermorelin Acetate is a high-quality specialised research peptide developed for advanced scientific exploration in endocrinology. Meticulously synthesised with ≥98% purity, it is supplied as a lyophilised solid for precise scientific studies.
Peptide Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Sermorelin (GRF 1-29) 2mgis supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. For best results, follow our website's detailed reconstitution and storage guidelines.
Legal and Safety Information
US-Peptides proudly provides Sermorelin (GRF 1-29) 2mg strictly for scientific and research use. We are dedicated to supporting the research community and ensuring our products meet stringent quality standards and legal requirements. Our peptides are not designed for human consumption or clinical application.
Stock: In Stock
ACE-031 1mg — a research-grade myostatin pathway inhibitor at 95% purity.
from
$79.00
Stock: In Stock
ACTH 1-39 5mg — full-length adrenocorticotropic hormone for research.
from
$85.00
Stock: In Stock
ADAMAX 5mg — research-grade peptide for cognitive function studies.
from
$49.00
Stock: In Stock
AOD 9604 2mg — a modified fragment of human growth hormone for research.
from
$27.95